Download free
empty asphalt road in between row of trees
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
1,000,000+ Free Images › Feelings Images › Cool Images & Photos

empty asphalt road in between row of trees

Infinite road

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D800
SafetyFree to use under the Unsplash License
roadroadsLandscape images & picturesHd wallpapersTree images & picturesHd wallpapersHq background imageswayscenicinfinityasphaltstraightjourneyavenuevanishing pointpineHd green wallpapersgravelplantlandPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

mine
210 images · Curated by colleen thermos
mineHd wallpapersoutdoor
road
17 images · Curated by Shealyn Sladick
roadHd wallpapersHq background images