Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Avatar of user Yulia Gadalina
Yulia Gadalina
Download free, beautiful high-quality photos curated by Yulia.
A map markerGothenburg, Sweden
Interests
adventuremountainsnaturesunsettraveling
  • A photoPhotos 48
  • A stack of foldersCollections 0
Go to Yulia Gadalina's profile
Yulia Gadalina
bare trees under blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
brown trees under blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
brown and white concrete building under blue sky
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
white and brown concrete building
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
white and brown flowers on gray textile
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
brown rock formation near body of water during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
sun setting over the horizon
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
white car on road during night time
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
city with snow under gray sky
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
sun setting over the forest
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green grass field near body of water under blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green grass field near body of water under white clouds during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
white van near green grass field and mountain under white clouds and blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green and brown mountain under blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green and brown mountain under blue sky during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
brown wooden dock on lake near mountain under white clouds during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green mountain beside body of water under white clouds during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
white wooden house near trees during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
person in brown hiking shoes standing on rocky ground near body of water during daytime
Download
Go to Yulia Gadalina's profile
Yulia Gadalina
green grass field under blue sky during daytime
Download
bare trees under blue sky during daytime
brown and white concrete building under blue sky
brown rock formation near body of water during daytime
white car on road during night time
sun setting over the forest
green grass field near body of water under white clouds during daytime
green and brown mountain under blue sky during daytime
brown wooden dock on lake near mountain under white clouds during daytime
white wooden house near trees during daytime
green grass field under blue sky during daytime
brown trees under blue sky during daytime
white and brown concrete building
white and brown flowers on gray textile
sun setting over the horizon
city with snow under gray sky
green grass field near body of water under blue sky during daytime
white van near green grass field and mountain under white clouds and blue sky during daytime
green and brown mountain under blue sky during daytime
green mountain beside body of water under white clouds during daytime
person in brown hiking shoes standing on rocky ground near body of water during daytime
bare trees under blue sky during daytime
white and brown concrete building
sun setting over the horizon
green grass field near body of water under blue sky during daytime
green and brown mountain under blue sky during daytime
green mountain beside body of water under white clouds during daytime
green grass field under blue sky during daytime
brown trees under blue sky during daytime
white and brown flowers on gray textile
white car on road during night time
green grass field near body of water under white clouds during daytime
green and brown mountain under blue sky during daytime
white wooden house near trees during daytime
brown and white concrete building under blue sky
brown rock formation near body of water during daytime
city with snow under gray sky
sun setting over the forest
white van near green grass field and mountain under white clouds and blue sky during daytime
brown wooden dock on lake near mountain under white clouds during daytime
person in brown hiking shoes standing on rocky ground near body of water during daytime

Yulia's work appears in the following categories

adventureanimalblossomblueblue skybrownbuildingcloudcountrysidefieldflowergrasslandgreengreyhikinglandscapemoonmountainnew zealandoutdoorpinkplantpurplesceneryscenicskysunsetvietnamPublic domain images
Unsplash logo

Make something awesome