Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Avatar of user Shiva Mardahi
Shiva Mardahi
Architect Love photography
A map markerIran
Instagram iconInstagram
Interests
architecturecityfoodnatureplant
  • A photoPhotos 614
  • A stack of foldersCollections 0
Go to Shiva Mardahi's profile
Shiva Mardahi
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Misty autumn forest with colorful trees on hills.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant yellow, orange, and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant yellow, orange, and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant red and yellow colors
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant shades of yellow and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves changing color on a branch
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with colorful trees and fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in warm colors on tree branches
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant red and yellow colors
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn tree with vibrant orange leaves in forest.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest path covered in fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest path covered in fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn trees with golden leaves covering the ground.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with fallen leaves and trees.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with a small stream and fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with a small stream and fallen leaves
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest floor covered in fallen leaves
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with fallen leaves and trees
Download
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves changing color on a branch
Autumn leaves in warm colors on tree branches
Autumn tree with vibrant orange leaves in forest.
Autumn forest path covered in fallen leaves.
Autumn forest with fallen leaves and trees.
Autumn forest with a small stream and fallen leaves.
Autumn forest floor covered in fallen leaves
Misty autumn forest with colorful trees on hills.
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in vibrant red and yellow colors
Autumn leaves in vibrant shades of yellow and red.
Autumn forest with colorful trees and fallen leaves.
Autumn leaves in vibrant red and yellow colors
Autumn forest path covered in fallen leaves.
Autumn trees with golden leaves covering the ground.
Autumn forest with a small stream and fallen leaves
Autumn forest with fallen leaves and trees
Autumn leaves in vibrant shades of yellow and red.
Autumn forest with colorful trees and fallen leaves.
Autumn tree with vibrant orange leaves in forest.
Autumn trees with golden leaves covering the ground.
Autumn forest floor covered in fallen leaves
Autumn forest with fallen leaves and trees
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in vibrant red and yellow colors
Autumn leaves changing color on a branch
Autumn leaves in vibrant red and yellow colors
Autumn forest path covered in fallen leaves.
Autumn forest with a small stream and fallen leaves
Misty autumn forest with colorful trees on hills.
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in warm colors on tree branches
Autumn forest path covered in fallen leaves.
Autumn forest with fallen leaves and trees.
Autumn forest with a small stream and fallen leaves.

Shiva's work appears in the following categories

8mm movieartart supplybackgroundcloudcolorcolored pencilcolor pencildesktop backgroundfieldfilmflowerglass wallgreenlakelandscapeleaflightmountainpancakepencilpictureplantshadowskysnow mountainstonetreewallpaperwoodPublic domain images
Unsplash logo

Make something awesome