Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Avatar of user Shiva Mardahi
Shiva Mardahi
Architect Love photography
A map markerIran
Instagram iconInstagram
Interests
architecturecityfoodnatureplant
  • A photoPhotos 620
  • A stack of foldersCollections 0
Go to Shiva Mardahi's profile
Shiva Mardahi
Green algae bloom on the surface of water
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Green algae bloom on the surface of water
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Green trees line a still, reflective body of water.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
A white bird stands in shallow water with grass.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
A white egret stands in shallow water near reeds.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Misty autumn forest with colorful trees on hills.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant yellow, orange, and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant yellow, orange, and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant red and yellow colors
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant shades of yellow and red.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves changing color on a branch
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest with colorful trees and fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in warm colors on tree branches
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn leaves in vibrant red and yellow colors
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn tree with vibrant orange leaves in forest.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest path covered in fallen leaves.
Download
Go to Shiva Mardahi's profile
Shiva Mardahi
Autumn forest path covered in fallen leaves.
Download
Green algae bloom on the surface of water
Green trees line a still, reflective body of water.
A white bird stands in shallow water with grass.
Misty autumn forest with colorful trees on hills.
Autumn leaves in vibrant yellow, orange, and red.
Autumn forest with colorful trees and fallen leaves.
Autumn leaves in vibrant red and yellow colors
Autumn forest path covered in fallen leaves.
Green algae bloom on the surface of water
A white egret stands in shallow water near reeds.
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in vibrant red and yellow colors
Autumn leaves in vibrant shades of yellow and red.
Autumn leaves changing color on a branch
Autumn leaves in warm colors on tree branches
Autumn tree with vibrant orange leaves in forest.
Autumn forest path covered in fallen leaves.
Green algae bloom on the surface of water
A white bird stands in shallow water with grass.
Misty autumn forest with colorful trees on hills.
Autumn leaves in vibrant red and yellow colors
Autumn leaves changing color on a branch
Autumn leaves in vibrant red and yellow colors
Autumn forest path covered in fallen leaves.
Green algae bloom on the surface of water
A white egret stands in shallow water near reeds.
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in vibrant shades of yellow and red.
Autumn forest with colorful trees and fallen leaves.
Autumn tree with vibrant orange leaves in forest.
Green trees line a still, reflective body of water.
Autumn leaves in vibrant yellow, orange, and red.
Autumn leaves in warm colors on tree branches
Autumn forest path covered in fallen leaves.

Shiva's work appears in the following categories

8mm movieartart supplybackgroundcloudcolorcolored pencilcolor pencildesktop backgroundfieldfilmflowerglass wallgreenlakelandscapeleaflightmountainpancakepencilpictureplantshadowskysnow mountainstonetreewallpaperwoodPublic domain images
Unsplash logo

Make something awesome