Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Avatar of user Rafael Cisneros Méndez
Rafael Cisneros Méndez
My main objective is to develop professionally and evolve in my sector, so I look for opportunities that allow me to do so, while trying to improve my skills according to the practice and execution of my projects. ..::Pictures by me::..
A map markerPlaya del Carmen, Quintana Roo
Instagram iconInstagram
Interests
FilmGoproNikonPhotoPicture
  • A photoPhotos 60
  • A stack of foldersCollections 0
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
woman in black tank top wearing black sunglasses
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
woman in black framed eyeglasses
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
a brick street with potted plants on the side of it
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
woman in blue bikini top on beach during daytime
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
brown bread on brown wooden plate
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
brown and white round ornament
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
woman in white red and blue long sleeve dress standing on brown field during daytime
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
Download
Go to Rafael Cisneros Méndez's profile
Rafael Cisneros Méndez
3 men riding on boat during daytime
Download
woman in black tank top wearing black sunglasses
a brick street with potted plants on the side of it
woman in white red and blue long sleeve dress standing on brown field during daytime
3 men riding on boat during daytime
woman in black framed eyeglasses
woman in blue bikini top on beach during daytime
brown bread on brown wooden plate
brown and white round ornament
woman in black tank top wearing black sunglasses
woman in blue bikini top on beach during daytime
a brick street with potted plants on the side of it
brown and white round ornament
woman in black framed eyeglasses
brown bread on brown wooden plate
woman in white red and blue long sleeve dress standing on brown field during daytime
3 men riding on boat during daytime

Rafael's work appears in the following categories

accessoryarchitecturebluebolognesebuildingcitycookingdinnerfoodgownhigh risehousehousinghumanitalymansionmealnoodleoffice buildingpastumrobeseasoningsesameskylightspaghettiswedentowertownurbanwindowPublic domain images
Unsplash logo

Make something awesome