Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Avatar of user David Stroia
David Stroia
Hobby photography Sony does it!
A map markerRomania
Instagram iconInstagram
Interests
landscapeskytravelwallpaper
  • A photoPhotos 44
  • A stack of foldersCollections 0
Go to David Stroia's profile
David Stroia
Download
Go to David Stroia's profile
David Stroia
Download
Go to David Stroia's profile
David Stroia
Brown car door covered in water droplets
Download
Go to David Stroia's profile
David Stroia
Download
Go to David Stroia's profile
David Stroia
Download
Go to David Stroia's profile
David Stroia
Man holding hat up at outdoor event with speakers
Download
Go to David Stroia's profile
David Stroia
Crowd of people waving romanian flags on a street
Download
Go to David Stroia's profile
David Stroia
Bouquet of roses in ukrainian flag colors
Download
Go to David Stroia's profile
David Stroia
American and romanian flags wave in the wind.
Download
Go to David Stroia's profile
David Stroia
Person in blue coat with rifle and backpack
Download
Go to David Stroia's profile
David Stroia
People holding romanian flags and wearing hats.
Download
Go to David Stroia's profile
David Stroia
People holding a banner with a man's face
Download
Go to David Stroia's profile
David Stroia
Men in historical military uniforms with rifles
Download
Go to David Stroia's profile
David Stroia
Soldiers in uniform with machine guns and sandbags.
Download
Go to David Stroia's profile
David Stroia
People walk past a tall column of colorful balloons.
Download
Go to David Stroia's profile
David Stroia
Building with "cosmopolitan" sign and flags
Download
Go to David Stroia's profile
David Stroia
Man in historical red uniform standing near stone archway
Download
Go to David Stroia's profile
David Stroia
Man in historical red uniform with musket and hat.
Download
Go to David Stroia's profile
David Stroia
Soldiers in vintage uniforms with colorful sashes and belts.
Download
Go to David Stroia's profile
David Stroia
Antique brass telescope on a stand.
Download
Brown car door covered in water droplets
Crowd of people waving romanian flags on a street
Bouquet of roses in ukrainian flag colors
Person in blue coat with rifle and backpack
People holding a banner with a man's face
Soldiers in uniform with machine guns and sandbags.
Building with "cosmopolitan" sign and flags
Man in historical red uniform with musket and hat.
Man holding hat up at outdoor event with speakers
American and romanian flags wave in the wind.
People holding romanian flags and wearing hats.
Men in historical military uniforms with rifles
People walk past a tall column of colorful balloons.
Man in historical red uniform standing near stone archway
Soldiers in vintage uniforms with colorful sashes and belts.
Antique brass telescope on a stand.
Person in blue coat with rifle and backpack
People holding romanian flags and wearing hats.
People walk past a tall column of colorful balloons.
Soldiers in vintage uniforms with colorful sashes and belts.
Crowd of people waving romanian flags on a street
Bouquet of roses in ukrainian flag colors
People holding a banner with a man's face
Building with "cosmopolitan" sign and flags
Man in historical red uniform standing near stone archway
Antique brass telescope on a stand.
Brown car door covered in water droplets
Man holding hat up at outdoor event with speakers
American and romanian flags wave in the wind.
Men in historical military uniforms with rifles
Soldiers in uniform with machine guns and sandbags.
Man in historical red uniform with musket and hat.

David's work appears in the following categories

animalarchitecturebackgroundbluebuildingcarcitydarkfarmfieldgreylandscapelightlondonmountainmusicnightretroroadskystreettechtechnologytravelvehiclevintagewallpaperwaterwebsitewildlifePublic domain images
Unsplash logo

Make something awesome