Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Avatar of user Nicolas M.
Nicolas M.
Download free, beautiful high-quality photos curated by Nicolas.
A map markerParis - France
Interests
cityflowerlandscapeseasky
  • A photoPhotos 65
  • A stack of foldersCollections 0
Go to Nicolas M.'s profile
Nicolas M.
A blackbird with a yellow beak perched on a dark tree branch
Download
Go to Nicolas M.'s profile
Nicolas M.
A black crow perched on a ledge before a grey lattice fence
Download
Go to Nicolas M.'s profile
Nicolas M.
A Eurasian collared dove with a distinctive black neck ring and red eyes
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
Golden-crowned kinglet perches on dry branches
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
A majestic white swan with an orange beak
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
A bar-headed goose stands on green foliage
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
A brown spotted bird perches on a tree branch
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
Go to Nicolas M.'s profile
Nicolas M.
A cormorant bird with white frosted feathers on its head
Download
Go to Nicolas M.'s profile
Nicolas M.
A jay bird rests on a tree branch with blossoms
Download
Go to Nicolas M.'s profile
Nicolas M.
A kingfisher perched on a tree branch
Download
Go to Nicolas M.'s profile
Nicolas M.
Download
A blackbird with a yellow beak perched on a dark tree branch
Golden-crowned kinglet perches on dry branches
A bar-headed goose stands on green foliage
A brown spotted bird perches on a tree branch
A cormorant bird with white frosted feathers on its head
A black crow perched on a ledge before a grey lattice fence
A Eurasian collared dove with a distinctive black neck ring and red eyes
A majestic white swan with an orange beak
A jay bird rests on a tree branch with blossoms
A kingfisher perched on a tree branch
A blackbird with a yellow beak perched on a dark tree branch
A majestic white swan with an orange beak
A bar-headed goose stands on green foliage
A kingfisher perched on a tree branch
A black crow perched on a ledge before a grey lattice fence
Golden-crowned kinglet perches on dry branches
A cormorant bird with white frosted feathers on its head
A Eurasian collared dove with a distinctive black neck ring and red eyes
A brown spotted bird perches on a tree branch
A jay bird rests on a tree branch with blossoms

Nicolas's work appears in the following categories

animalaustraliabackgroundcitydarkdogflowergrassgreengreyhealthhikinglandscapeleafeminimalmountainparisplantpurpleseaskysummersunrisesunsettreewaterwebsitewildlifePublic domain images
Unsplash logo

Make something awesome