Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Avatar of user Andy Bhula
Andy Bhula
Download free, beautiful high-quality photos curated by Andy.
Interests
architecturecitylandscapetravel
  • A photoPhotos 2
  • A stack of foldersCollections 0
Go to Andy Bhula's profile
Andy Bhula
a view of a city from a rooftop
Download
Go to Andy Bhula's profile
Andy Bhula
a view of a city and a body of water
Download
a view of a city from a rooftop
a view of a city and a body of water
a view of a city from a rooftop
a view of a city and a body of water

Andy's work appears in the following categories

architecturecitiscapecitygalata towergolden hornistanbuli̇stanbulistanbul wallpaperlandscapeskylinetraveltravelphotographyturkeytürkiyePublic domain images
Unsplash logo

Make something awesome