Download free
photography of water waves
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Featured in

Photos

photography of water waves

Ocean rippling

A map markerPeninsula Park, Newport Beach, United States
Calendar outlinedPublished on CameraCanon, EOS 6DSafetyFree to use under the Unsplash License
textureseabluelakewaveswaverippleswimrippleswetroughgreyoutdoorsunited statesnewport beachPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20