Download free
a large crater in the middle of a desert

Views

33,199,801

Downloads

463,694

Featured in

Photos, Nature, Wallpapers

a large crater in the middle of a desert

Download this free HD photo of wallpaper, desktop wallpapers, desert, and rock by NASA (@nasa)

A map markerSirenum Fossae, Mars
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
wallpaperdesktop wallpapersdesertrockemailcontactwallpapersvalleyaerialdesktop backgroundsamazing wallpapercool backgroundscomputer backgroundscraterformationtumblr backgroundsravinesatellite viewoverheadbackgroundPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related images

top view land under clouds
Arrow pointing down
view of Earth and satellite
Arrow pointing down
top view photography of brown islands
Arrow pointing down
Hurricane as seen from space
Arrow pointing down
moon photography
Arrow pointing down
photography of purple and green aurora beam below grey space satellite
Arrow pointing down
a blurry image of a multicolored background
aerial photograph of islands
Arrow pointing down
an artist's rendering of a space station in orbit
a blurry image of a blue and white background
person walking near brown rock
Arrow pointing down
Satellite image of river
Arrow pointing down
a blurry image of a blue, yellow, and purple background
satellite flying on space
Arrow pointing down
A space satellite hovering above the coastline
Arrow pointing down
aerial photo of coastline
Arrow pointing down
Pluto on a black background
Arrow pointing down
a blurry image of a green and blue background
brown textile
Arrow pointing down
blue starry night
Arrow pointing down