Download free
yellow painted road line
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

yellow painted road line

Download this free HD photo of pittsburgh, usa, pa, and bridge by Dylan Sauerwein (@rawdyl)

A map markerPittsburgh, PA, USA
Calendar outlinedPublished on CameraSONY, ILCE-7RM2
SafetyFree to use under the Unsplash License
pittsburghusapabridgeLandscape images & picturesyellow bridgesymmetricalsymmetrylinesperspectivestormy skyHd yellow wallpaperspennsylvaniabridgesbuildingfreewaytarmacasphalthighwaysuspension bridgePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

pycon
35 images · Curated by Natalie Robb
pyconpittsburghbuilding
Phone Wallpapers
105 images · Curated by Sowren Sen
Hd wallpapersoutdoorvalley
Bridges
3 images · Curated by Carlos Fabre
bridgereflectionbuilding