Download free
cars on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

cars on road during daytime

Download this free HD photo of tehran, iran, tehran province, and road in Tehran, Iran by Amir Hosseini (@mmpixz)

A map markerTehran, Tehran Province, Iran
Calendar outlinedPublished on CameraCanon, EOS 90D
SafetyFree to use under the Unsplash License
tehranirantehran provinceroadcity vibecity vibesmoody roadbridge constructionbridgesautobahnHd grey wallpaperstransportationautomobilefreewaytarmacasphalthighwayhumanPeople images & picturesintersectionPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20