Download free
black liquid in white ceramic cup beside keyboard
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
HQ Background Images › Art Backgrounds

black liquid in white ceramic cup beside keyboard

From the Studio Mornings collection. Full collection at kellybrito.com

A map markerNew York, United States
Calendar outlinedPublished on CameraCanon, EOS 70D
SafetyFree to use under the Unsplash License
Coffee imagesHd white wallpapersofficeNew york pictures & imagesunited statesworkworkspaceblogcoasterbloggerdeskplantsflatlayleaveshardwareelectronicscomputer keyboardLeaf backgroundstextvegetationPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Work
37 images · Curated by Feuza Reis
workWebsite backgroundsbusiness
Coffee
66 images · Curated by Mavyn Design
Coffee imagesdrinkFood images & pictures
NEW 3.10
12 images · Curated by Caroline Alfini
deskworkaccessory