Download free
black and gray video camera
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

black and gray video camera

Filming with an expensive Sachtler tri-pod and fluid head for an interview series.

A map markerBoston, MA, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D850
SafetyFree to use under the Unsplash License
usamabostonfiltergradevideographerstudioHd art wallpaperstri podvideofluid headtechgearequipmentexpensivefilmingfilmsachtlerweaponweaponrygunPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Film
50 images · Curated by Polina Kuzovkova
film35mm filmfilm photography