Download free
a group of people sitting next to each other
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a group of people sitting next to each other

Picture taken by Nathan Pellerin during a ResKP tour // www.reskp.fr

A map markerNîmes, France
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
francenîmeslaughlaughingfriendFriendship imagesfriendsreskpchristianitychristian livinghumanheadfaceHappy images & picturesmalemanadultfemaleWomen images & picturessmilePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Focus, Focus, FOCUS
83 images · Curated by RhondaK Native Florida Folk Artist
Animals images & picturesHd grey wallpapersunited state
pantone
41 images · Curated by Siham Hors
pantoneFlower imagesHd pink wallpapers